Package Bio :: Package SeqUtils :: Module ProtParam
[hide private]
[frames] | no frames]

Module ProtParam

source code

Simple protein analysis.

Example,

X = ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV")
print(X.count_amino_acids())
print(X.get_amino_acids_percent())
print(X.molecular_weight())
print(X.aromaticity())
print(X.instability_index())
print(X.flexibility())
print(X.isoelectric_point())
print(X.secondary_structure_fraction())
print(X.protein_scale(ProtParamData.kd, 9, 0.4))

Classes [hide private]
  ProteinAnalysis
Class containing methods for protein analysis.
Variables [hide private]
  __package__ = 'Bio.SeqUtils'