From p.j.a.cock at googlemail.com Thu Mar 3 05:37:07 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 3 Mar 2011 10:37:07 +0000 Subject: [Biopython-dev] Biopython 1.57 release plans Message-ID: Hi all, It is probably about time to do the Biopython 1.57 release. Thanks to Tiago's work on the buildbot, see http://testing.open-bio.org for this, we can be reasonably confident that all the offline unit tests are passing on the main platforms and different versions of Python. However, it would be a good idea for people to run the full test suite on their machines now. What (minor) issues need to be addressed? Note I don't want this to be an excuse to land any big units of code (but now would be a good time to discuss preparations for merging after the release is done). Would anyone like to proof read the current tutorial? You don't need to mess about with LaTeX since there should be a nightly update here: http://biopython.org/DIST/docs/tutorial/Tutorial-dev.html http://biopython.org/DIST/docs/tutorial/Tutorial-dev.pdf Regards, Peter From anaryin at gmail.com Thu Mar 3 06:35:14 2011 From: anaryin at gmail.com (=?UTF-8?Q?Jo=C3=A3o_Rodrigues?=) Date: Thu, 3 Mar 2011 12:35:14 +0100 Subject: [Biopython-dev] Biopython 1.57 release plans In-Reply-To: References: Message-ID: Hey Peter, should we include the Bio.PDB things we've been discussing for a while now? That has been a bit quiet lately so I dunno how it stands with you guys. Cheers, Jo?o On Thu, Mar 3, 2011 at 11:37 AM, Peter Cock wrote: > Hi all, > > It is probably about time to do the Biopython 1.57 release. > > Thanks to Tiago's work on the buildbot, see http://testing.open-bio.org > for this, we can be reasonably confident that all the offline unit tests > are passing on the main platforms and different versions of Python. > However, it would be a good idea for people to run the full test suite > on their machines now. > > What (minor) issues need to be addressed? > > Note I don't want this to be an excuse to land any big units of code (but > now would be a good time to discuss preparations for merging after the > release is done). > > Would anyone like to proof read the current tutorial? You don't need to > mess about with LaTeX since there should be a nightly update here: > http://biopython.org/DIST/docs/tutorial/Tutorial-dev.html > http://biopython.org/DIST/docs/tutorial/Tutorial-dev.pdf > > Regards, > > Peter > _______________________________________________ > Biopython-dev mailing list > Biopython-dev at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/biopython-dev > From p.j.a.cock at googlemail.com Thu Mar 3 06:41:15 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 3 Mar 2011 11:41:15 +0000 Subject: [Biopython-dev] Biopython 1.57 release plans In-Reply-To: References: Message-ID: On Thu, Mar 3, 2011 at 11:35 AM, Jo?o Rodrigues wrote: > Hey Peter, should we include the Bio.PDB things we've been discussing for a > while now? That has been a bit quiet lately so I dunno how it stands with > you guys. I'm tempted to say no, try and get the release out within a week, and then work with you and Eric to merge the code. I'm worried the merge might push the release back, and I would like to get it out this month. What's your impression Eric? Also which github branch are you considering merging? I can do a trial merge (offline) and run some tests here (I have access to all the main platforms). Peter From eric.talevich at gmail.com Thu Mar 3 15:10:34 2011 From: eric.talevich at gmail.com (Eric Talevich) Date: Thu, 3 Mar 2011 15:10:34 -0500 Subject: [Biopython-dev] Biopython 1.57 release plans In-Reply-To: References: Message-ID: On Thu, Mar 3, 2011 at 6:41 AM, Peter Cock wrote: > On Thu, Mar 3, 2011 at 11:35 AM, Jo?o Rodrigues wrote: > > Hey Peter, should we include the Bio.PDB things we've been discussing for > a > > while now? That has been a bit quiet lately so I dunno how it stands with > > you guys. > > I'm tempted to say no, try and get the release out within a week, and > then work with you and Eric to merge the code. I'm worried the merge > might push the release back, and I would like to get it out this month. > What's your impression Eric? > Jo?o, I'm sorry to put this off again -- but I think we should do that merge after the 1.57 release. The API for the functions renumber_residues and remove_disordered_atoms is tricky to get right, because they have to support so many variations on the same concept. I'd like to give dev-version testers some time with it before locking down the API with a stable release. I'm looking at the NEWS file and I don't see any mention of the GSoC work that we already merged -- was that in time for the 1.56 release, or just after? Here's what's already in 1.57 (pre-release): - index_db(), which I think people will really like - Blast+ support: blast_formatter - Some improvements to SeqiO and SeqRecord - Last release to support Python 2.4, for real this time Dropping 2.4 support might also let us tighten up the Bio.PDB code a bit. > Also which github branch are you considering merging? I can do a trial > merge (offline) and run some tests here (I have access to all the main > platforms). > It's here: https://github.com/JoaoRodrigues/biopython/commits/pdb_enhancements Comment on remove_disordered_atoms: I'm trying to think of a more obvious way to make the "Average" option work. It's the default, so users won't normally have to type it, but having "A" and "Average" seems prone to autocomplete issues (mentally or in the IDE). How about making "average" lowercase? Best, Eric From p.j.a.cock at googlemail.com Thu Mar 3 15:16:40 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 3 Mar 2011 20:16:40 +0000 Subject: [Biopython-dev] Testing examples in the Tutorial Message-ID: Hi all, In part prompted by recent discussions on the BioPerl and BioRuby mailing lists about documentation and testing, I was inspired to try and code up something I'd been thinking about doing for some time: treat the embedded examples in our tutorial as doctests. This required adding a little extra markup to the LaTeX file since I wanted the tests to be "opt in" (some examples will not make good tests, for example random outputs or command line tool dependencies). I've gone for a special comment line, %doctest (which can include an optional name for the test) to mark the the following verbatim block is a doctest. Likewise, %cont-doctest indicates the following verbatim block is a continuation of the previous doctest - important when there is text in the middle so variable definitions or import statements would otherwise need to be repeated. Then I wrote test_Tutorial.py which parses Tutorial.tex to find these examples, and turn them into doctests. It is a bit hacky but appears to do the job. Running it like this: python run_tests.py test_Tutorial.py you can very minimal output from failures. For more details, use this: python test_Tutorial.py I've already marked up some basic Seq examples (and in the process fixed a couple of trivial errors and one typo) so you can see how this works: https://github.com/biopython/biopython/commit/dd3f5f7cf9a4bd120e4b8634f530f6de0b873622 Yes, maybe I should have asked before committing this, but I wanted to run it on all our platforms via the buildbot. That was a good idea as the is a tuple issue on Jython and Python 2.4 that I've seen before: https://github.com/biopython/biopython/commit/45cb3e05aa86c96820a3d866d766d0fc62cb830a So, any comments or feedback? If people have ideas for improvement that's great - otherwise I think we should begin to mark up the rest of Tutorial.tex for maximum test coverage... Peter From p.j.a.cock at googlemail.com Thu Mar 3 15:22:46 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 3 Mar 2011 20:22:46 +0000 Subject: [Biopython-dev] Biopython 1.57 release plans In-Reply-To: References: Message-ID: 2011/3/3 Eric Talevich : > On Thu, Mar 3, 2011 at 6:41 AM, Peter Cock wrote: >> >> On Thu, Mar 3, 2011 at 11:35 AM, Jo?o Rodrigues wrote: >> > Hey Peter, should we include the Bio.PDB things we've been discussing >> > for a >> > while now? That has been a bit quiet lately so I dunno how it stands >> > with >> > you guys. >> >> I'm tempted to say no, try and get the release out within a week, and >> then work with you and Eric to merge the code. I'm worried the merge >> might push the release back, and I would like to get it out this month. >> What's your impression Eric? > > Jo?o, I'm sorry to put this off again -- but I think we should do that merge > after the 1.57 release. The API for the functions renumber_residues and > remove_disordered_atoms is tricky to get right, because they have to support > so many variations on the same concept. I'd like to give dev-version testers > some time with it before locking down the API with a stable release. OK then. > I'm looking at the NEWS file and I don't see any mention of the GSoC work > that we already merged -- was that in time for the 1.56 release, or just > after? > > Here's what's already in 1.57 (pre-release): > > ?- index_db(), which I think people will really like > ?- Blast+ support: blast_formatter > ?- Some improvements to SeqiO and SeqRecord Yeah, making sure nothing major is missing in the NEWS file is on the TODO list for each release. I thought it was up to date... > > ?- Last release to support Python 2.4, for real this time > > > Dropping 2.4 support might also let us tighten up the Bio.PDB code a bit. > Looks about right - on the Python 2.4 side, I'm hoping other projects like Galaxy will drop Python 2.4 ASAP, and that Biopython 1.57 really will be the last release to work on Python 2.4 (all be it lacking some features). In practice many of the things Python 2.4 lacks (e.g. SQLite) also apply to Jython, but that is a different issue really. >> >> Also which github branch are you considering merging? I can do a trial >> merge (offline) and run some tests here (I have access to all the main >> platforms). > > It's here: > https://github.com/JoaoRodrigues/biopython/commits/pdb_enhancements > > Comment on remove_disordered_atoms: I'm trying to think of a more obvious > way to make the "Average" option work. It's the default, so users won't > normally have to type it, but having "A" and "Average" seems prone to > autocomplete issues (mentally or in the IDE). How about making "average" > lowercase? > Probably best to discuss this on a new thread. Also consider "mean" since there is more than one average ;) Peter From p.j.a.cock at googlemail.com Thu Mar 3 15:32:11 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 3 Mar 2011 20:32:11 +0000 Subject: [Biopython-dev] Fwd: [Bosc] Bioinformatics Open Source Conference (BOSC 2011)--Call for Abstracts In-Reply-To: <3922D2BE-5A99-4CDE-91AB-B311C42E10CE@lbl.gov> References: <3922D2BE-5A99-4CDE-91AB-B311C42E10CE@lbl.gov> Message-ID: Dear Biopythoneers, BOSC will be in Vienna, Austria this year. Peter ---------- Forwarded message ---------- From: Nomi Harris Date: Thu, Mar 3, 2011 at 7:37 PM Subject: [Bosc] Bioinformatics Open Source Conference (BOSC 2011)--Call for Abstracts To: bosc-announce at lists.open-bio.org, members at open-bio.org, GMOD Announcements List , GMOD Developers List Cc: Nomi Harris We invite you to submit an abstract to BOSC 2011! ?Please forward this message as appropriate, and forgive multiple postings. Call for Abstracts for the 12th Annual Bioinformatics Open Source Conference (BOSC 2011) An ISMB 2011 Special Interest Group (SIG) Dates: July 15-16, 2011 Location: Vienna, Austria Web site: http://www.open-bio.org/wiki/BOSC_2011 Email: bosc at open-bio.org BOSC announcements mailing list: http://lists.open-bio.org/mailman/listinfo/bosc-announce Important Dates: April 18, 2011: Deadline for submitting abstracts to BOSC 2011 May 9, 2011: Notifications of accepted abstracts emailed to corresponding authors July 13-14, 2011: Codefest 2011 programming session (see http://www.open-bio.org/wiki/Codefest_2011 for details) July 15-16, 2011: BOSC 2011 July 17-19, 2011: ISMB 2011 The Bioinformatics Open Source Conference (BOSC) is sponsored by the Open Bioinformatics Foundation (O|B|F), a non-profit group dedicated to promoting the practice and philosophy of Open Source software development within the biological research community. To be considered for acceptance, software systems representing the central topic in a presentation submitted to BOSC must be licensed with a recognized Open Source License, and be freely available for download in source code form. We invite you to submit abstracts for talks and posters. ?Sessions include: - Approaches to parallel processing - Cloud-based approaches to improving software and data accessibility - The Semantic Web in open source bioinformatics - Data visualization - Tools for next-generation sequencing - Other Open Source software In addition to the above sessions, there will be a panel discussion about "Meeting the challenges of inter-institutional collaboration". We are also working to arrange a joint session with one of the other ISMB SIGs. Thanks to generous sponsorship from Eagle Genomics and an anonymous donor, we are pleased to announce a competition for three Student Travel Awards for BOSC 2011. Each winner will be awarded $250 to defray the costs of travel to BOSC 2011. For instructions on submitting your abstract, please visit http://www.open-bio.org/wiki/BOSC_2011#Abstract_Submission_Information BOSC 2011 Organizing Committee: Nomi Harris and Peter Rice (co-chairs); Brad Chapman, Peter Cock, Erwin Frise, Darin London, Ron Taylor _______________________________________________ BOSC mailing list BOSC at lists.open-bio.org http://lists.open-bio.org/mailman/listinfo/bosc From tiagoantao at gmail.com Thu Mar 3 18:27:45 2011 From: tiagoantao at gmail.com (=?ISO-8859-1?Q?Tiago_Ant=E3o?=) Date: Thu, 3 Mar 2011 23:27:45 +0000 Subject: [Biopython-dev] buildbot failure in Biopython on Linux 64 - Jython 2.5.2 In-Reply-To: <201103032000.p23K0Fhp002513@testing.open-bio.org> References: <201103032000.p23K0Fhp002513@testing.open-bio.org> Message-ID: On Thu, Mar 3, 2011 at 8:00 PM, wrote: > ?http://testing.open-bio.org:8010/buildbotbuilders/Linux%2064%20-%20Jython%202.5.2/builds/61 Argh... these links are wrong. I will have a look. From bugzilla-daemon at portal.open-bio.org Mon Mar 7 10:48:56 2011 From: bugzilla-daemon at portal.open-bio.org (bugzilla-daemon at portal.open-bio.org) Date: Mon, 7 Mar 2011 10:48:56 -0500 Subject: [Biopython-dev] [Bug 2968] Modifications to Emboss eprimer3 parser and associated files In-Reply-To: Message-ID: <201103071548.p27Fmum8005492@portal.open-bio.org> http://bugzilla.open-bio.org/show_bug.cgi?id=2968 ------- Comment #3 from biopython-bugzilla at maubp.freeserve.co.uk 2011-03-07 10:48 EST ------- I've committed some fixes based on Leighton's ideas, https://github.com/biopython/biopython/commit/b550da19d1749bb160711d240074010ebbd7252f -- Configure bugmail: http://bugzilla.open-bio.org/userprefs.cgi?tab=email ------- You are receiving this mail because: ------- You are the assignee for the bug, or are watching the assignee. From komalsnehal1991 at gmail.com Tue Mar 8 02:58:11 2011 From: komalsnehal1991 at gmail.com (Komal S) Date: Tue, 8 Mar 2011 13:28:11 +0530 Subject: [Biopython-dev] Biopython Projects Message-ID: Hi everyone, I'm Komal, a Junior Undergraduate Student from India studying Bioengineering. I'm a fan of Python and I love Computational Biology and I plan to do my further studies in the same. I went through the projects on the Biopython page. I was very much interested in the RNA Structure project mentioned. Any contribution which I make will help me a lot and the organisation too. In fact, I am currently doing a project on RNA Editing. I'll be very happy to integrate my knowledge. Please help me on how I should proceed. Komal From komalsnehal1991 at gmail.com Wed Mar 9 05:49:23 2011 From: komalsnehal1991 at gmail.com (Komal S) Date: Wed, 9 Mar 2011 02:49:23 -0800 Subject: [Biopython-dev] ::Biopython Project Message-ID: Hi everyone, I'm Komal, a Junior Undergraduate Student from India studying Bioengineering. I'm a fan of Python and I love Computational Biology and I plan to do my further studies in the same. I went through the projects on the Biopython page. I was very much interested in the RNA Structure project mentioned. Any contribution which I make will help me a lot and the organisation too. In fact, I am currently doing a project on RNA Editing. I'll be very happy to integrate my knowledge. In fact, I have been trying to contact people on #obf-soc IRC. I think there is no separate IRC for Biopython. Please help me on how I should proceed. Komal From p.j.a.cock at googlemail.com Wed Mar 9 05:58:33 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Wed, 9 Mar 2011 10:58:33 +0000 Subject: [Biopython-dev] Biopython Projects In-Reply-To: References: Message-ID: On Tue, Mar 8, 2011 at 7:58 AM, Komal S wrote: > Hi everyone, > > I'm Komal, a Junior Undergraduate Student from India studying > Bioengineering. I'm a fan of Python and I love Computational Biology and I > plan to do my further studies in the same. > I went through the projects on the Biopython page. I was very much > interested in the RNA Structure project mentioned. Any contribution which I > make will help me a lot and the organisation too. In fact, I am currently > doing a project on RNA Editing. I'll be very happy to integrate my > knowledge. > > Please help me on how I should proceed. > > Komal Hi Kamal, Since you expressed an interest in the RNA structure project list here, http://www.biopython.org/wiki/Active_projects I was hoping Kristian would comment. I have CC'd him on this email. Peter P.S. Are you interested in the Google Summer of Code, or in general? From krother at rubor.de Wed Mar 9 06:36:14 2011 From: krother at rubor.de (Kristian Rother) Date: Wed, 9 Mar 2011 12:36:14 +0100 Subject: [Biopython-dev] [Biopython] ::Biopython Project In-Reply-To: References: Message-ID: Hi, I'll take Peters hint to give a short summary what is going on on RNA at biopython. Actually, there are three lines of development: - Adding an extended sequence format that can handle modified RNA nucleotides (works with preliminary tests done). - Adding some simple parsers for common RNA 2D structure formats (Vienna, Ct, Bpseq) (something already works). - Adding the FCCD loop closer algorithm by Thomas Hamelryck (got the code but needs to be contributed). Basically all three require at the moment an independent person to take a look at them and state 'yes, this is useful for me' (if so). Komal, if you like to get involved could you write a little about what you are working with (RNA editing). If we find something thats not too far off for you we could get it moving. Best regards, Kristian > Hi everyone, > > I'm Komal, a Junior Undergraduate Student from India > studying Bioengineering. I'm a fan of Python and I love Computational > Biology and I plan to do my further studies in the same. > I went through the projects on the Biopython page. I was very > much interested in the RNA Structure project mentioned. Any contribution > which I make will help me a lot and the organisation too. In fact, I am > currently doing a project on RNA Editing. I'll be very happy to integrate > my knowledge. > > In fact, I have been trying to contact people on #obf-soc IRC. I think > there > is no separate IRC for Biopython. > > Please help me on how I should proceed. > > > Komal > _______________________________________________ > Biopython mailing list - Biopython at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/biopython > > From komalsnehal1991 at gmail.com Wed Mar 9 08:00:04 2011 From: komalsnehal1991 at gmail.com (Komal S) Date: Wed, 9 Mar 2011 05:00:04 -0800 Subject: [Biopython-dev] Biopython Projects In-Reply-To: References: Message-ID: Hi Peter, Thanks a lot for your reply. Well, both. I really don't know whether OBF has applied for GSOC this year or not. If yes, GSOC will help me a lot. Nonetheless, I want to involve myself in Computational Biology related projects so that they help me in the future. I'm planning a PhD in Computational Biology in the next 2 years. I want a good background and experience for that. Komal On Wed, Mar 9, 2011 at 2:58 AM, Peter Cock wrote: > On Tue, Mar 8, 2011 at 7:58 AM, Komal S wrote: > > Hi everyone, > > > > I'm Komal, a Junior Undergraduate Student from India studying > > Bioengineering. I'm a fan of Python and I love Computational Biology and > I > > plan to do my further studies in the same. > > I went through the projects on the Biopython page. I was very much > > interested in the RNA Structure project mentioned. Any contribution which > I > > make will help me a lot and the organisation too. In fact, I am currently > > doing a project on RNA Editing. I'll be very happy to integrate my > > knowledge. > > > > Please help me on how I should proceed. > > > > Komal > > Hi Kamal, > > Since you expressed an interest in the RNA structure project list here, > http://www.biopython.org/wiki/Active_projects I was hoping Kristian > would comment. I have CC'd him on this email. > > Peter > > P.S. Are you interested in the Google Summer of Code, or in general? > From komalsnehal1991 at gmail.com Wed Mar 9 08:18:00 2011 From: komalsnehal1991 at gmail.com (Komal S) Date: Wed, 9 Mar 2011 05:18:00 -0800 Subject: [Biopython-dev] [Biopython] ::Biopython Project In-Reply-To: References: Message-ID: Hi Kristian, Well, my work is basically the construction of a database of RNA Editing. I'm part of a team from UCC, Ireland. I joined this project around a month ago. I'm interested in this project and I'm ready to get involved. Komal On Wed, Mar 9, 2011 at 3:36 AM, Kristian Rother wrote: > > Hi, > > I'll take Peters hint to give a short summary what is going on on > RNA at biopython. Actually, there are three lines of development: > > - Adding an extended sequence format that can handle modified RNA > nucleotides (works with preliminary tests done). > - Adding some simple parsers for common RNA 2D structure formats (Vienna, > Ct, Bpseq) (something already works). > - Adding the FCCD loop closer algorithm by Thomas Hamelryck (got the code > but needs to be contributed). > > Basically all three require at the moment an independent person to take a > look at them and state 'yes, this is useful for me' (if so). > > Komal, if you like to get involved could you write a little about what you > are working with (RNA editing). If we find something thats not too far off > for you we could get it moving. > > Best regards, > Kristian > > > > > Hi everyone, > > > > I'm Komal, a Junior Undergraduate Student from India > > studying Bioengineering. I'm a fan of Python and I love Computational > > Biology and I plan to do my further studies in the same. > > I went through the projects on the Biopython page. I was very > > much interested in the RNA Structure project mentioned. Any contribution > > which I make will help me a lot and the organisation too. In fact, I am > > currently doing a project on RNA Editing. I'll be very happy to integrate > > my knowledge. > > > > In fact, I have been trying to contact people on #obf-soc IRC. I think > > there > > is no separate IRC for Biopython. > > > > Please help me on how I should proceed. > > > > > > Komal > > _______________________________________________ > > Biopython mailing list - Biopython at lists.open-bio.org > > http://lists.open-bio.org/mailman/listinfo/biopython > > > > > > From anaryin at gmail.com Wed Mar 9 08:23:54 2011 From: anaryin at gmail.com (=?UTF-8?Q?Jo=C3=A3o_Rodrigues?=) Date: Wed, 9 Mar 2011 14:23:54 +0100 Subject: [Biopython-dev] [Biopython] ::Biopython Project In-Reply-To: References: Message-ID: Hello Komal, I assume you're talking about this: http://www.ncbi.nlm.nih.gov/pubmed/20547637. Which features from the current Biopython RNA modules would fit your work and how do you think you could improve them? Do you already have some ideas? Cheers, J From p.j.a.cock at googlemail.com Thu Mar 10 12:42:58 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Thu, 10 Mar 2011 17:42:58 +0000 Subject: [Biopython-dev] Bugzilla -> Redmine migration Message-ID: Hi all, Anyone who has tried to file a bug recently will have noticed a big red message "Sorry, entering bugs into the product Biopython has been disabled." The reason for this is the OBF team are about to move us (and all the other Bio* projects using Bugzilla) to a Redmine server instead. See http://www.redmine.org/ I expect this to be completed in the next few days (with all the old bugs and accounts carried across). Hopefully this will include integration with our git repository as well. We'll make an announcement once it is ready, in the mean time, any new bugs could be emailed to the mailing list as a short term measure. Peter From updates at feedmyinbox.com Sat Mar 12 04:11:34 2011 From: updates at feedmyinbox.com (Feed My Inbox) Date: Sat, 12 Mar 2011 04:11:34 -0500 Subject: [Biopython-dev] 3/12 biopython Questions - BioStar Message-ID: <59619d8d66b2e5c275645a69e1951352@74.63.51.88> // Plotting DNA sequence traces // March 11, 2011 at 11:00 AM http://biostar.stackexchange.com/questions/6356/plotting-dna-sequence-traces I have read/consulted these two threads here, the ABI file format document, the BioPython project, the R project, the BioConductor project and have searched extensively on the Internet, but I am not able to find an answer or explanation for what I would like to do. I would like to know how to interpret trace data from an ABI/AB1 trace file and how to plot this data. Ideally, I'd like to plot it on a web-page (in some format that allows for scrolling of course, but I haven't thought that much about this yet), but first I need to understand the trace data itself and how to plot it with Python and/or R. -- Website: http://biostar.stackexchange.com/questions/tagged/biopython Account Login: https://www.feedmyinbox.com/members/login/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email Unsubscribe here: http://www.feedmyinbox.com/feeds/unsubscribe/630206/59fe8f28e93f5744d887807619020b5988c5b82b/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email -- This email was carefully delivered by FeedMyInbox.com. PO Box 682532 Franklin, TN 37068 From updates at feedmyinbox.com Fri Mar 18 09:05:29 2011 From: updates at feedmyinbox.com (Feed My Inbox) Date: Fri, 18 Mar 2011 09:05:29 -0400 Subject: [Biopython-dev] 3/18 biopython Questions - BioStar Message-ID: // Error translating genbank CDS using BioPython // March 17, 2011 at 4:28 AM http://biostar.stackexchange.com/questions/6560/error-translating-genbank-cds-using-biopython Hi all, I'm trying to translate the a genbank record using BioPython 1.53, ignoring the already given translation in the CDS feature. The code I've written to translate this is pretty straight forward: ... for gb_record in SeqIO.parse(file_handle, 'genbank'):#Bio.GenBank.Record for gb_feature in gb_record.features:#Bio.SeqFeature #Skip any non coding sequence features if gb_feature.type != 'CDS': continue #Protein identifier is a property of the genbank feature protein_id = gb_feature.qualifiers['protein_id'][0] #Original sequence retrieved through BioPython 1.53+'s internal method extracted_seq = gb_feature.extract(gb_record.seq)#Bio.Seq.Seq #Translation table is a property of the genbank feature transl_table = gb_feature.qualifiers['transl_table'][0] #Translate entire sequence as coding sequence using translation table #Additional CodonTables optionally available from Bio.Data.CodonTable try: protein_seq = extracted_seq.translate(table = transl_table, cds = True) except TranslationError, err: log.error('%s: Error in translating %s\n%s', gb_record.id, protein_id, extracted_seq) raise err #Write out fasta. Header format as requested: >genome_ac|protein_id _write_fasta_line(write_handle, '{0}|{1}'.format(gb_record.id, protein_id), str(protein_seq)) The translate line throws a TranslationError on the following feature: CDS complement(2276255..2279302) /locus_tag="ECBD_2165" /EC_number="1.7.99.4" /inference="protein motif:TFAM:TIGR01553" /note="KEGG: ssn:SSON_1650 formate dehydrogenase-N, nitrate-inducible, alpha subunit; TIGRFAM: formate dehydrogenase, alpha subunit; PFAM: molybdopterin oxidoreductase; molybdopterin oxidoreductase Fe4S4 region; molydopterin dinucleotide-binding region" /codon_start=1 /transl_except=(pos:complement(2278715..2278717),aa:Sec) /transl_table=11 /product="formate dehydrogenase, alpha subunit" /protein_id="YP_003036386.1" /db_xref="GI:253773555" /db_xref="InterPro:IPR006311" /db_xref="InterPro:IPR006443" /db_xref="InterPro:IPR006655" /db_xref="InterPro:IPR006656" /db_xref="InterPro:IPR006657" /db_xref="InterPro:IPR006963" /db_xref="GeneID:8157271" /translation="MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAK EIRNTCTYCSVGCGLLMYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYV NSENRLRYPEYRAPGSDKWQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLS TGMLCASGASNETGMLTQKFARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWV DIKNANVVMVMGGNAAEAHPVGFRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIR SGTDITFLSGVLRYLIENNKINAEYVKHYTNASLLVRDDFAFEDGLFSGYDAEKRQYD KSSWNYQFDENGYAKRDETLTHPRCVWNLLKEHVSRYTPDVVENICGTPKADFLKVCE VLASTSAPDRTTTFLYALGWTQHTVGAQNIRTMAMIQLLLGNMGMAGGGVNALRGHSN IQGLTDLGLLSTSLPGYLTLPSEKQVDLQSYLEANTPKATLADQVNYWSNYPKFFVSL MKSFYGDAAQKENNWGYDWLPKWDQTYDVIKYFNMMDEGKVTGYFCQGFNPVASFPDK NKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESNDVDPASIQTEVFRLPSTCFAEEDG SIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHLRELYQAEGGKGVEPLMKMSWNY KQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLLSSFAHLRDDGTTASSCWIYT GSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYNRASADINGKPWDPKRMLI QWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINKMAEGPFPEHYEPIETP LGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEHFHTWTKHALLNAIA QPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPLNVNGQQVETVGI PIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA" root: ERROR: NC_012947.1: Error in translating YP_003036386.1 ATGGACGTCAGTCGCAGACAATTTTTTAAAATCTGCGCGGGCGGTATGGCTGGAACAACGGTAGCGGCATTGGGCTTTGCCCCGAAGCAAGCACTGGCTCAGGCGCGAAACTACAAATTATTACGCGCTAAAGAGATCCGTAACACCTGCACATACTGTTCCGTAGGTTGCGGGCTATTGATGTATAGCCTGGGTGATGGCGCGAAAAACGCCAGAGAAGCGATTTATCACATTGAAGGTGACCCGGATCATCCGGTAAGCCGTGGTGCGCTGTGCCCAAAAGGGGCCGGTTTGCTGGATTACGTCAACAGCGAAAACCGTCTGCGCTACCCGGAATATCGTGCGCCAGGTTCTGACAAATGGCAGCGCATTAGCTGGGAAGAAGCATTCTCCCGTATTGCAAAGCTGATGAAAGCTGACCGTGACGCTAACTTTATTGAAAAGAACGAGCAGGGCGTAACGGTAAACCGTTGGCTTTCTACCGGTATGCTGTGTGCCTCCGGTGCCAGCAACGAAACCGGGATGCTGACACAGAAATTTGCCCGCTCCCTCGGGATGCTGGCGGTAGACAACCAGGCGCGCGTCTGACACGGACCAACGGTAGCAAGTCTTGCTCCAACATTTGGTCGCGGTGCGATGACCAACCACTGGGTGGATATCAAAAACGCTAACGTCGTAATGGTAATGGGCGGTAACGCTGCTGAAGCGCATCCCGTCGGTTTCCGCTGGGCGATGGAAGCGAAAAACAACAACGATGCAACCTTGATCGTTGTCGATCCTCGTTTTACGCGTACCGCTTCTGTGGCGGATATTTACGCACCTATTCGTTCCGGTACGGACATTACGTTCCTGTCTGGCGTTTTGCGCTACCTGATCGAAAACAACAAAATCAACGCCGAATACGTTAAACATTACACCAACGCCAGCCTGCTGGTGCGTGATGATTTTGCTTTCGAAGATGGCCTGTTCAGCGGTTATGACGCTGAAAAACGCCAGT ACGACAAATCGTCCTGGAACTATCAGTTCGATGAAAACGGCTATGCGAAACGCGATGAAACACTGACTCATCCGCGCTGTGTGTGGAACCTGCTGAAAGAGCACGTTTCCCGCTACACGCCGGACGTCGTTGAAAACATCTGCGGTACGCCAAAAGCCGACTTCCTGAAAGTGTGTGAAGTGCTGGCCTCCACCAGCGCACCGGATCGCACAACCACCTTCCTGTACGCGCTGGGCTGGACGCAGCACACCGTGGGTGCGCAGAACATCCGTACTATGGCGATGATCCAGTTACTGCTCGGTAACATGGGTATGGCCGGTGGCGGCGTGAACGCATTGCGTGGTCACTCCAACATTCAGGGCCTGACTGACTTAGGTCTGCTCTCTACCAGCCTGCCAGGTTATCTGACGCTGCCGTCAGAAAAACAGGTTGATTTGCAGTCGTATCTGGAAGCGAACACGCCGAAAGCGACGCTGGCTGATCAGGTGAACTACTGGAGCAACTATCCGAAGTTCTTCGTTAGCCTGATGAAATCTTTCTATGGCGATGCCGCGCAGAAAGAGAACAACTGGGGCTATGACTGGCTGCCGAAGTGGGACCAGACCTACGACGTCATCAAGTATTTCAACATGATGGACGAAGGCAAAGTCACCGGTTATTTCTGCCAGGGCTTTAACCCGGTTGCGTCCTTCCCGGACAAAAACAAAGTGGTGAGCTGCCTGAGCAAGCTGAAGTACATGGTGGTTATCGATCCGCTGGTGACTGAAACCTCTACCTTCTGGCAGAACCACGGCGAGTCGAACGATGTCGATCCGGCGTCTATTCAGACTGAAGTATTCCGTCTGCCTTCGACCTGCTTTGCTGAAGAAGATGGTTCTATTGCTAACTCCGGTCGCTGGCTGCAGTGGCACTGGAAAGGTCAGGATGCGCCGGGCGAAGCGCGTAACGACGGTGAAATTCTGGCGGGTATCTACCATCACCTGCGCGAGCTGTACCA GGCCGAAGGTGGTAAAGGCGTAGAACCGCTGATGAAGATGAGCTGGAACTACAAGCAGCCGCACGAACCGCAATCTGACGAAGTAGCTAAAGAGAACAACGGCTATGCGCTGGAAGATCTCTATGATGCTAATGGCGTGCTGATTGCGAAGAAAGGTCAGTTGCTGAGTAGCTTTGCGCATCTGCGTGATGACGGTACAACCGCATCTTCTTGCTGGATCTACACCGGTAGCTGGACAGAGCAGGGCAACCAGATGGCTAACCGCGATAACTCCGACCCGTCCGGTCTGGGGAATACGCTGGGATGGGCCTGGGCGTGGCCGCTCAACCGTCGCGTGCTGTACAACCGTGCTTCGGCGGATATCAACGGTAAACCGTGGGATCCGAAACGGATGCTGATCCAGTGGAACGGCAGCAAGTGGACGGGTAACGATATTCCTGACTTCGGCAATGCCGCACCGGGTACGCCAACCGGGCCGTTTATCATGCAGCCGGAAGGGATGGGACGCCTGTTTGCTATCAACAAAATGGCGGAAGGTCCGTTCCCGGAACACTACGAGCCGATTGAAACGCCGCTGGGCACTAACCCGCTGCATCCGAACGTGGTGTCTAACCCGGTTGTTCGTCTGTATGAACAAGACGCACTGCGGATGGGTAAAAAAGAGCAGTTCCCGTATGTGGGTACGACCTATCGTCTGACCGAGCACTTCCACACCTGGACCAAGCACGCATTGCTCAACGCAATTGCTCAGCCGGAACAGTTTGTGGAAATCAGCGAAACGCTGGCGGCGGCGAAAGGCATTAATAATGGCGATCGTGTCACTGTCTCAAGCAAGCGTGGCTTTATCCGCGCGGTGGCTGTGGTAACGCGTCGTCTGAAACCACTGAATGTAAATGGTCAGCAGGTTGAAACGGTGGGTATTCCAATCCACTGGGGCTTTGAGGGTGTCGCGCGTAAAGGTTATATCGCTAACACTCTGACGCCGAATGTCGGTGAT GCAAACTCGCAAACGCCGGAATATAAAGCGTTCTTAGTCAACATCGAGAAGGCGTAA Error: Traceback (most recent call last): File "/usr/lib/python2.6/unittest.py", line 279, in run testMethod() File "/home/user/jenkins/workspace/Divergence/divergence/src/divergence/test/test_translate.py", line 33, in test_translate_ecoli_and_salmo fasta_file = translate_genbank_to_protein(genbank_file, ptt_file) File "/home/user/jenkins/workspace/Divergence/divergence/src/divergence/translate.py", line 73, in translate_genbank_to_protein raise err TranslationError: Extra in frame stop codon found. Now I'm guessing this has something to do with the /transl_except I'm seeing in the GenBank record, but I'm not (yet) sure. (The GenBank supplied translation contains a Selenocysteine.) But even if this is the cause: How would I properly handle this in my BioPython translation? I can't find any method to exclude certain sections from translation.. Can anyone help me fix the translation? Best regards, Tim (Ps. Should anyone wonder why I'm not using the translation in the GenBank file directly: It's a requirement that I translate from the DNA sequence to protein myself...) -- Website: http://biostar.stackexchange.com/questions/tagged/biopython Account Login: https://www.feedmyinbox.com/members/login/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email Unsubscribe here: http://www.feedmyinbox.com/feeds/unsubscribe/630206/59fe8f28e93f5744d887807619020b5988c5b82b/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email -- This email was carefully delivered by FeedMyInbox.com. PO Box 682532 Franklin, TN 37068 From mnaik28 at gmail.com Wed Mar 23 01:50:59 2011 From: mnaik28 at gmail.com (Medha Naik) Date: Wed, 23 Mar 2011 00:50:59 -0500 Subject: [Biopython-dev] Project ideas for CS grad Message-ID: <4D898A43.5010407@gmail.com> Hi All, I am a Computer Science Master's student from Texas with an inclination towards Bioinformatics. I love coding in Python and would like to contribute to some code development in Biopython. I do have basic understanding of the biology and genetics concepts in bioinformatics but I am primarily looking to work on the computational aspects like coding some algorithms, data structures or database interactions. I read Dan Gusfield's book, 'Algorithms on Strings, Trees and Sequences', as part of my coursework and got interested in implementing an algorithm or two from the same using the sequence and tree classes already defined in Biopython. Is there any open project that I could contribute to by doing the above? I do not want to independently begin something without some guidance from a person from the team. I am open to all ideas/suggestions and I hope that I can contribute something to this amazing module that integrates python, computer science concepts and biology! Regards, Medha Naik From updates at feedmyinbox.com Wed Mar 23 04:06:27 2011 From: updates at feedmyinbox.com (Feed My Inbox) Date: Wed, 23 Mar 2011 04:06:27 -0400 Subject: [Biopython-dev] 3/23 active questions tagged biopython - Stack Overflow Message-ID: // marking up mutation positions in a sequence with html in python // March 22, 2011 at 7:03 AM http://stackoverflow.com/questions/5390170/marking-up-mutation-positions-in-a-sequence-with-html-in-python Hello, I was wondering if there are any methods in python or biopython that allows one to markup a sequence in html. I would like to mark positions on a sequence (ie colour bases differently) according to if that position is a known snp/indel etc Having a list of mutation positions in an array (read from a database) eg mutation_position = [10,20,30,40] I can change case for the affected base using something like: seq = seq[0:b] + mutation_positions[b].lower() + seq[(b+1):len(seq)] But is it possible to add some html code eg add the tag pos for each of the mutation positions. (when the html markup is added to the sequence, the length of the sequence is altered and so the mutation positions don't match to the newly marked up sequence during each iteration of the loop!) I hope this makes sense! Thanks. -- Website: http://stackoverflow.com/questions/tagged/?tagnames=biopython&sort=active Account Login: https://www.feedmyinbox.com/members/login/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email Unsubscribe here: http://www.feedmyinbox.com/feeds/unsubscribe/630208/9a33fac9c8e89861715f609a2333362c8425e495/?utm_source=fmi&utm_medium=email&utm_campaign=feed-email -- This email was carefully delivered by FeedMyInbox.com. PO Box 682532 Franklin, TN 37068 From p.j.a.cock at googlemail.com Sun Mar 27 09:32:28 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Sun, 27 Mar 2011 14:32:28 +0100 Subject: [Biopython-dev] New test_Phylo.py test on Python 3 Message-ID: Hi Eric, You'll need to handle None explicitly for the comparison to pass under Python 3 (see below), or you get: Traceback (most recent call last): ... File "/home/buildslave/BuildBot/lin3264/build/build/py3.2/Tests/test_Phylo.py", line 280, in tree.collapse_all(lambda c: c.branch_length < 0.1) TypeError: unorderable types: NoneType() < float() http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.2/builds/100/steps/shell/logs/stdio http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.1/builds/179/steps/shell/logs/stdio Regards, Peter ---------- Forwarded message ---------- From: Date: Sun, Mar 27, 2011 at 4:12 AM Subject: buildbot failure in Biopython on Linux 64 - Python 3.2 To: p.j.a.cock at googlemail.com, tiagoantao at gmail.com The Buildbot has detected a new failure on builder Linux 64 - Python 3.2 while building Biopython. Full details are available at: ?http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.2/builds/100 Buildbot URL: http://testing.open-bio.org/biopython/ Buildslave for this Build: peter_linux64 Build Reason: The Nightly scheduler named 'nightly' triggered this build Build Source Stamp: HEAD Blamelist: BUILD FAILED: failed shell sincerely, ?-The Buildbot From p.j.a.cock at googlemail.com Mon Mar 28 08:43:40 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Mon, 28 Mar 2011 13:43:40 +0100 Subject: [Biopython-dev] Fwd: [Biopython - Bug #3187] pip install biopython In-Reply-To: References: Message-ID: Hi Brad (et al), It looks like automatic emails from Redmine to the biopython-dev list are not working properly... anyway, could you take a look at Bug 3187? https://redmine.open-bio.org/issues/3187 I suspect this is related to PIP issue 8, i.e. PIP doesn't like our setup.py file. https://github.com/pypa/pip/issues/8 Thanks, Peter ---------- Forwarded message ---------- From: Date: Mon, Mar 28, 2011 at 1:35 PM Subject: [Biopython - Bug #3187] pip install biopython To: casbon at gmail.com Cc: p.j.a.cock at googlemail.com Issue #3187 has been updated by James Casbon. File pip.log added It's pretty much the same as the output I posted, but I have attached. ________________________________ Bug #3187: pip install biopython Author: James Casbon Status: New Priority: Normal Assignee: Category: Main Distribution Target version: URL: james at flapjack:/tmp$ virtualenv bp-pip New python executable in bp-pip/bin/python Installing setuptools............done. james at flapjack:/tmp$ source /tmp/bp-pip/bin/activate (bp-pip)james at flapjack:/tmp$ pip install biopython Downloading/unpacking biopython Downloading biopython-1.56.tar.gz (6.9Mb): 6.9Mb downloaded Running setup.py egg_info for package biopython warning: no previously-included files found matching 'Tests/Graphics/*.pdf' warning: no previously-included files found matching 'Tests/Graphics/*.eps' warning: no previously-included files found matching 'Tests/Graphics/*.svg' warning: no previously-included files found matching 'Tests/Graphics/*.png' warning: no previously-included files matching '*' found under directory 'Tests/UnitTests' warning: no previously-included files matching '.cvsignore' found under directory '*' warning: no previously-included files matching '.gitignore' found under directory '*' warning: no previously-included files matching '*.pyc' found under directory '*' Installing collected packages: biopython Running setup.py install for biopython usage: -c [global_opts] cmd1 [cmd1_opts] [cmd2 [cmd2_opts] ...] or: -c --help [cmd1 cmd2 ...] or: -c --help-commands or: -c cmd --help error: option --single-version-externally-managed not recognized Complete output from command /private/tmp/bp-pip/bin/python -c "import setuptools; __file__='/private/tmp/bp-pip/build/biopython/setup.py'; execfile('/private/tmp/bp-pip/build/biopython/setup.py')" install --single-version-externally-managed --record /var/folders/Gn/GneSaDeKGaGpZXx+hcopdU+++TI/-Tmp-/pip-slq1Hy-record/install-record.txt --install-headers /private/tmp/bp-pip/bin/../include/site/python2.7: usage: -c [global_opts] cmd1 [cmd1_opts] [cmd2 [cmd2_opts] ...] or: -c --help [cmd1 cmd2 ...] or: -c --help-commands or: -c cmd --help error: option --single-version-externally-managed not recognized ---------------------------------------- Command /private/tmp/bp-pip/bin/python -c "import setuptools; __file__='/private/tmp/bp-pip/build/biopython/setup.py'; execfile('/private/tmp/bp-pip/build/biopython/setup.py')" install --single-version-externally-managed --record /var/folders/Gn/GneSaDeKGaGpZXx+hcopdU+++TI/-Tmp-/pip-slq1Hy-record/install-record.txt --install-headers /private/tmp/bp-pip/bin/../include/site/python2.7 failed with error code 1 Storing complete log in /Users/james/.pip/pip.log ________________________________ You have received this notification because you have either subscribed to it, or are involved in it. To change your notification preferences, please click here and login: http://redmine.open-bio.org From chapmanb at 50mail.com Mon Mar 28 09:36:39 2011 From: chapmanb at 50mail.com (Brad Chapman) Date: Mon, 28 Mar 2011 09:36:39 -0400 Subject: [Biopython-dev] Fwd: [Biopython - Bug #3187] pip install biopython In-Reply-To: References: Message-ID: <20110328133639.GD26383@sobchak> Peter; [pip install problem] > https://redmine.open-bio.org/issues/3187 Thanks for the heads up. I pushed a fix for this back in December, which was unfortunately post-1.56: https://github.com/biopython/biopython/commit/4e4c3aa1df3d6848afed4783c4e54186a751accd#setup.py What is our timeline for 1.57? If it's a long way out we can work on back-porting to 1.56 and re-upload. Brad From p.j.a.cock at googlemail.com Mon Mar 28 09:55:58 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Mon, 28 Mar 2011 14:55:58 +0100 Subject: [Biopython-dev] Fwd: [Biopython - Bug #3187] pip install biopython In-Reply-To: <20110328133639.GD26383@sobchak> References: <20110328133639.GD26383@sobchak> Message-ID: On Mon, Mar 28, 2011 at 2:36 PM, Brad Chapman wrote: > Peter; > > [pip install problem] >> https://redmine.open-bio.org/issues/3187 > > Thanks for the heads up. I pushed a fix for this back in December, > which was unfortunately post-1.56: > > https://github.com/biopython/biopython/commit/4e4c3aa1df3d6848afed4783c4e54186a751accd#setup.py > > What is our timeline for 1.57? If it's a long way out we can > work on back-porting to 1.56 and re-upload. I was hoping for some more comments on the tutorial, and ideally fix http://lists.open-bio.org/pipermail/biopython/2011-March/007130.html but other than that we're good to go. Do you want to do the honours? Peter From eric.talevich at gmail.com Mon Mar 28 10:17:46 2011 From: eric.talevich at gmail.com (Eric Talevich) Date: Mon, 28 Mar 2011 10:17:46 -0400 Subject: [Biopython-dev] New test_Phylo.py test on Python 3 In-Reply-To: References: Message-ID: Thanks, Peter. The build bot is pretty handy! My fix was here, for the public record: https://github.com/biopython/biopython/commit/8edd552b72a31179cd53eb1493ac5462f7fb8f7c Lambda expressions like the one in test_Phylo.py are supposed to Just Work, since manually handling all the edge cases for comparisons is tedious (or impossible, since try/except statements aren't allowed in Python's lambda expressions). So I fixed the way Bio.Phylo wraps lambda expressions, instead. -E On Sun, Mar 27, 2011 at 9:32 AM, Peter Cock wrote: > Hi Eric, > > You'll need to handle None explicitly for the comparison to pass under > Python 3 (see below), or you get: > > Traceback (most recent call last): > ... > File > "/home/buildslave/BuildBot/lin3264/build/build/py3.2/Tests/test_Phylo.py", > line 280, in > tree.collapse_all(lambda c: c.branch_length < 0.1) > TypeError: unorderable types: NoneType() < float() > > > http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.2/builds/100/steps/shell/logs/stdio > > http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.1/builds/179/steps/shell/logs/stdio > > Regards, > > Peter > > ---------- Forwarded message ---------- > From: > Date: Sun, Mar 27, 2011 at 4:12 AM > Subject: buildbot failure in Biopython on Linux 64 - Python 3.2 > To: p.j.a.cock at googlemail.com, tiagoantao at gmail.com > > > The Buildbot has detected a new failure on builder Linux 64 - Python > 3.2 while building Biopython. > Full details are available at: > > http://testing.open-bio.org/biopython/builders/Linux%2064%20-%20Python%203.2/builds/100 > > Buildbot URL: http://testing.open-bio.org/biopython/ > > Buildslave for this Build: peter_linux64 > > Build Reason: The Nightly scheduler named 'nightly' triggered this build > Build Source Stamp: HEAD > Blamelist: > > BUILD FAILED: failed shell > > sincerely, > -The Buildbot > From redmine at redmine.open-bio.org Mon Mar 28 11:04:43 2011 From: redmine at redmine.open-bio.org (redmine at redmine.open-bio.org) Date: Mon, 28 Mar 2011 15:04:43 +0000 Subject: [Biopython-dev] [Biopython - Bug #3188] Test bug, please ignore References: Message-ID: Issue #3188 has been updated by Chris Fields. Assignee set to Biopython Developer's retesting with dev account ---------------------------------------- Bug #3188: Test bug, please ignore https://redmine.open-bio.org/issues/3188 Author: Peter Cock Status: New Priority: Normal Assignee: Biopython Developer's Category: Target version: URL: The aim of this bug is to test the Redmine "Email on New Issue" option from the Newissuealerts module. This issue should get emailed to the biopython-dev email list automatically... Peter -- You have received this notification because you have either subscribed to it, or are involved in it. To change your notification preferences, please click here and login: http://redmine.open-bio.org From chapmanb at 50mail.com Tue Mar 29 08:05:32 2011 From: chapmanb at 50mail.com (Brad Chapman) Date: Tue, 29 Mar 2011 08:05:32 -0400 Subject: [Biopython-dev] 1.57 release plans In-Reply-To: References: <20110328133639.GD26383@sobchak> Message-ID: <20110329120532.GL26383@sobchak> Peter; > > What is our timeline for 1.57? > I was hoping for some more comments on the tutorial, and ideally fix > http://lists.open-bio.org/pipermail/biopython/2011-March/007130.html > but other than that we're good to go. Do you want to do the honours? For your fastq file examples, we could use the EBI short read archive, which is staying around for a while longer: ftp://ftp.sra.ebi.ac.uk/vol1/fastq/ERR000/ERR000001/ I can do on the release, but probably later this week or over the weekend. How do you normally get together the list of contributors? That, and the list of new features, are the major two things I'm not on top off. Thanks, Brad From p.j.a.cock at googlemail.com Tue Mar 29 08:26:21 2011 From: p.j.a.cock at googlemail.com (Peter Cock) Date: Tue, 29 Mar 2011 13:26:21 +0100 Subject: [Biopython-dev] 1.57 release plans In-Reply-To: <20110329120532.GL26383@sobchak> References: <20110328133639.GD26383@sobchak> <20110329120532.GL26383@sobchak> Message-ID: On Tue, Mar 29, 2011 at 1:05 PM, Brad Chapman wrote: > Peter; > >> > What is our timeline for 1.57? > >> I was hoping for some more comments on the tutorial, and ideally fix >> http://lists.open-bio.org/pipermail/biopython/2011-March/007130.html >> but other than that we're good to go. Do you want to do the honours? > > For your fastq file examples, we could use the EBI short read > archive, which is staying around for a while longer: > > ftp://ftp.sra.ebi.ac.uk/vol1/fastq/ERR000/ERR000001/ Good plan - why didn't I think of that the other night when I was looking at this? I may even be able to find the equivalent files to the ones we used to use from the NCBI SRA. I'll try and sort that today or tomorrow... > I can do on the release, but probably later this week or over the > weekend. Cool. That suits me. You can trigger builds on the buildbot manually (if you know the password...) and/or wait for the nightly scheduled build. That is quite handy for a final test just before tagging the repository and building the archives. Also useful if you don't have a suitable Windows machine handy - I can always do the Windows installers a day later (well, not on weekends). > How do you normally get together the list of contributors? > That, and the list of new features, are the major two things > I'm not on top off. I try to make sure that the NEWS file is kept up to date as we go along, so the "release announcement" is a prettified version of that really. You can take a bit more space to talk about new stuff, and really big bits of new code could even warrant their blog post on news.open-bio.org to help raise awareness. As usual circulating a draft release statement on the dev list is a good way to avoid missing anything really obvious :) Thanks, Peter