GSOC2010 Joao
m (→Support for MODELLER PIR format in SeqIO) |
(→Support for MODELLER PIR format in SeqIO: Edited mpir to pir-modeller) |
||
| Line 444: | Line 444: | ||
=== Support for MODELLER PIR format in SeqIO === | === Support for MODELLER PIR format in SeqIO === | ||
| − | MODELLER PIR format support was added to SeqIO as ' | + | MODELLER PIR format support was added to SeqIO as 'pir-modeller'. Currently, the format can be read but not written. An example of the format follows, as well as an example of the parser's usage. |
<pre> | <pre> | ||
| Line 457: | Line 457: | ||
handle = open('test_pir.txt') | handle = open('test_pir.txt') | ||
| − | records = SeqIO.parse(handle, ' | + | records = SeqIO.parse(handle, 'pir-modeller') |
for i in records: | for i in records: | ||
Latest revision as of 00:38, 13 August 2010
Contents
|
Author & Mentors
João Rodrigues anaryin@gmail.com
Mentors
- Eric Talevich
- Diana Jaunzeikare
- Peter Cock
Abstract
Biopython is a very popular library in Bioinformatics and Computational Biology. Its Bio.PDB module, originally developed by Thomas Hamelryck, is a simple yet powerful tool for structural biologists. Although it provides a reliable PDB parser feature and it allows several calculations (Neighbour Search, RMS) to be made on macromolecules, it still lacks a number of features that are part of a researcher's daily routine. Probing for disulphide bridges in a structure and adding polar hydrogen atoms accordingly are two examples that can be incorporated in Bio.PDB, given the module's clever structure and good overall organisation. Cosmetic operations such as chain removal and residue renaming – to account for the different existing nomenclatures – and renumbering would also be greatly appreciated by the community.
Another aspect that can be improved for Bio.PDB is a smooth integration/interaction layer for heavy-weights in macromolecule simulation such as MODELLER, GROMACS, AutoDock, HADDOCK. It could be argued that the easiest solution would be to code hooks to these packages' functions and routines. However, projects such as the recently developed edPDB or the more complete Biskit library render, in my opinion, such interfacing efforts redundant. Instead, I believe it to be more advantageous to include these software' input/output formats in Biopython's SeqIO and AlignIO modules. This, together with the creation of interfaces for model validation/structure checking services/software would allow Biopython to be used as a pre- and post-simulation tool. Eventually, it would pave the way for its inclusion in pipelines and workflows for structure modelling, molecular dynamics, and docking simulations.
Project Schedule
The schedule below was organised to be flexible, which means that some features will likely be done early. Also, the weeks include documentation and unit testing efforts for the features, with extended periods for reviewing these efforts at the two points during the project (halfway, final week).
Community Bonding Period
- Getting familiar with development environment (Git Hub account, Git, Biopython's repository, Bug tracking system, etc)
- Gather scientific literature and discuss some of the to-be-implemented methods.
Week 1 [31st May - 6th June]
Renumbering residues of a structure
- Read SEQRES record to account for gaps
- Alternatively read ATOM records.
Probe disulphide bridges in the structure
- Via NeighbourSearch class
- Also use SSBOND in header
Extract Biological Unit
- REMARK350 contains rotation and translation information
- If REMARK is absent, do nothing.
Week 2 [7th – 13th June]
Structure Hydrogenation
- Add all/polar hydrogens through interface with WHATIF server.
- Optionally define a set pH
Hydrogenation Report
- Produces a brief list of polar hydrogen atoms in the structure.
- Chain | Residue [number] | Atom
Weeks 3-5 [14th June- 4th July]
Removal of disordered atoms
Residue name normalisation
- Build conversion table from different nomenclatures (research them during c.bonding period )
- Write function to make a given structure compliant with a given software nomenclature:
- Amber
- CNS/HADDOCK
- GROMACS
Coarse Grain Structure
- Implement function to reduce complexity of a structure
- 1pt*c-alpha
- 2pt*c-alpha / c-beta
- 3pt*c-alpha / c-beta / side-chain pseudo-centroid OR side-chain centroid
Week 6 (Mid-Term) [5th - 11th July]
- Testing and consolidating the features thoroughly.
- Write documentation & examples for each feature, to be included in Biopython's Wiki and Bio.PDB's FAQ.
- Mid-term Evaluations. Discussing with mentors current state of project and adjust following schedule to comply with project's needs.
Week 7 [12th - 19th July]
Add support for MODELLER's PIR format to Biopython
- Format Description
- SeqIO
- AlignIO
Allow conversion of Structure Object to Sequence Object
- Based on Bio.PDB.Polypeptide function
Weeks 8-10 [20th July - 9th August]
Add Sequence/Structure Homology functions
- Create call to Biopython's BLAST interfaces
- Allow direct blast from structure object ( e.g. protein.find_homoseq() )
- Returns list of tuples with E-Value *Dictionary (name, length of alignment, etc..)
- Create interface with structural homology web services
- e.g. Dali server
- Return list of tuples with Z-Score*Dictionary (name, etc...)
Implement basic structure validation checks
- Via NeighbourSearch class
- Same Charge contacts
- Atom Clashes
- Via ResidueDepth Class
- Buried Charges
- Interface WHATIF PDBReport web service
- Parse WARNING and ERROR messages
Week 11 [10th - 17th August]
Reviewing documentation, code, write tests for new functions.
Project Code
Hosted at this GitHub branch
Project Progress
Since I'm adding some methods that are useful/logical only for proteins, having them exposed in Structure.py for every molecule could be misleading. We decided then to add a 'as_protein()' method that allows protein-specific methods to be accessed. The following example demonstrates how this call works. Note how the "search_ss_bonds" method is absent from dir(s) but not from dir(prot).
from Bio.PDB import PDBParser p = PDBParser() s = p.get_structure('example', '4PTI.pdb') dir(s) # Cut for viewing purposes ['__doc__', ... , 'renumber_residues', 'set_parent', 'xtra'] prot = s.as_protein() dir(prot) ['__doc__', ... , 'renumber_residues', 'search_ss_bonds', 'set_parent', 'xtra']
Renumbering residues of a structure
Since parse_pdb_header is far from optimal and is likely to change in the future, I opted to forfeit reading SEQREQ records to account for gaps. However, ignoring this information and renumbering based on ATOM records would make us lose information on gaps. I opted to subtract the first residue number-1 to all residues thus making the numbering start in 1 and still keep gaps. I also added an argument (start) to allow the user to set which number to start the counting from.
Example:
from Bio.PDB import PDBParser p = PDBParser() s = p.get_structure('example', '1IHM.pdb') print list(s.get_residues())[0] <Residue ASP het= resseq=1029 icode= > s.renumber_residues() print list(s.get_residues())[0] <Residue ASP het= resseq=1 icode= >
Probe disulphide bridges in the structure
The same rationale from SEQRES applies for the exclusion of looking up SSBOND. Also, instead of using NeighborSearch to look for pairs of cysteins in bond distance, I instead used the minus operator since it has been overloaded to return the distance between two atoms (Page 10 of the FAQ). The average distance cited in the literature is 2.05A but other software packages and my own tests set 3.0A as a good threshold. Still, the user can set his own threshold manually.
The function returns an iterator with tuples of pairs of residues.
from Bio.PDB import PDBParser p = PDBParser() s = p.get_structure('example', '4PTI.pdb') prot = s.as_protein() for bond in prot.search_ss_bonds(): print bond (<Residue CYS het= resseq=5 icode= >, <Residue CYS het= resseq=55 icode= >) (<Residue CYS het= resseq=14 icode= >, <Residue CYS het= resseq=38 icode= >) (<Residue CYS het= resseq=30 icode= >, <Residue CYS het= resseq=51 icode= >)
Extract Biological Unit
Added parsing for REMARK350 to parse_pdb_header since there was already a bit written for another REMARK section. This extracts the transformation matrices and the translation vector from the header, that is then fed to the Structure function. Each new rotated structure is created as a new MODEL. I chose this because crystal structures very rarely have more than one MODEL instance and also because NMR models don't have REMARK 350 that often (at least to my knowledge).
from Bio.PDB import PDBParser p = PDBParser() s1 = p.get_structure('a', '4PTI.pdb') s1.build_biological_unit() 'Processed 0 transformations on the structure.' # Identity matrix is ignored. s2 = p.get_structure('b', 'homol_1bd8.pdb') # A homology model s2.build_biological_unit() 'PDB File lacks appropriate REMARK 350 entries to build Biological Unit.' s3 = p.get_structure('c', '1IHM.pdb') s3.build_biological_unit() 'Processed 59 transformations on the structure.'
Hydrogenation of PDB files
Following discussion between the mentors and me, we decided that maybe it was better to not only include a webserver for this purpose but also a local algorithm. This would not limit the user when there he/she lacks an internet connection.
The interface for the WHATIF Protonation service has been implemented, although it should be regarded as **highly experimental** for now. Interfacing this server included writing a small parser for a PDBXML-like format, which is expected to have serious bugs in its initial versions. I ran some simple tests and it works. It doesn't support water molecules yet, nor any other molecules other than proteins. Such issues will be hopefully solved later on..
For those brave enough to want to test it (and help me debug it), here's an example usage.
from Bio.Struct.WWW import WHATIF from Bio import Struct server = WHATIF.WHATIF() # Performs a sort of PING to the server. Gracefully exits if the servers are down. # Get the protein structure structure = Struct.read('4PTI.pdb') protein = structure.as_protein() # This excludes water molecules # Upload the structure to the WHATIF server # This should convert the structure from a Structure object to a string via tempfile and PDBIO # I was having some issues uploading structures... id = server.UploadPDB(protein) # Protonate # Returns a Structure Object / WARNING! Bug prone for now. protein_h = server.PDBasXMLwithSymwithPolarH(id)
Regarding the local implementation, after much reading I settled on using PyMol's algorithm. It seems to allow for protonation of any structure, regardless of its nature (protein, DNA, etc). Its vectorial and matrix operations can likely be optimized with Numpy and Biopython's Vector.py module. This first implementation works for proteins only. I'll add general molecule support later.
from Bio import Struct from Bio.Struct import Hydrogenate as H s = Struct.read('1ctf.pdb') p = s.as_protein() prot = H.Hydrogenate_Protein() prot.add_hydrogens(p)
Coarse Grain Structure
A Center of Mass function was developed first as part of a new module Bio.Struct.Geometry. It allows for calculation of the center of geometry (all masses are equal) and center of mass (taking into account elemental masses for the atoms). The masses are a new Atom object feature derived from this list and from PyMol. Essentially, all atoms of a structure now get their mass defined when the Structure is created (check Atom.py and this thread for details). This is obviously experimental.
To calculate the center of mass of any Entity (Structure, Model, Chain, Residue) or a List of Atoms:
from Bio.Struct.Geometry import center_of_mass from Bio import Struct s = Struct.read('4PTI.pdb') print center_of_mass.__doc__ Returns gravitic or geometric center of mass of an Entity. Geometric assumes all masses are equal (geometric=True) Defaults to Gravitic. print center_of_mass(s) [14.833301303933874, 21.431581746366263, 4.1218478418007134] print center_of_mass(s, geometric=True) [14.805324902127458, 21.365571977563405, 4.1108949403803985]
As of now, 3 CG models are supported.
1) CA-Trace 2) ENCAD 3-point model (CA, O, Side Chain bead) 3) MARTINI protein model (BB, Side Chain points [S1 to S4])
An example, picking up the s Structure from above:
p = s.as_protein() # To expose the CG method ca_trace = p.coarse_grain() # One atom per residue print ( len(list(p.get_residues())) == len(list(ca_trace.get_atoms())) ) True cg_encad = p.coarse_grain('ENCAD_3P') for residue in cg_encad.get_residues(): print residue.resname, residue.child_list ARG [<Atom CA>, <Atom O>, <Atom CMA>] PRO [<Atom CA>, <Atom O>, <Atom CMA>] ASP [<Atom CA>, <Atom O>, <Atom CMA>] PHE [<Atom CA>, <Atom O>, <Atom CMA>] CYS [<Atom CA>, <Atom O>, <Atom CMA>] LEU [<Atom CA>, <Atom O>, <Atom CMA>] GLU [<Atom CA>, <Atom O>, <Atom CMA>] PRO [<Atom CA>, <Atom O>, <Atom CMA>] PRO [<Atom CA>, <Atom O>, <Atom CMA>] TYR [<Atom CA>, <Atom O>, <Atom CMA>] ..... CYS [<Atom CA>, <Atom O>, <Atom CMA>] GLY [<Atom CA>, <Atom O>] GLY [<Atom CA>, <Atom O>] ALA [<Atom CA>, <Atom O>, <Atom CMA>] cg_martini = p.coarse_grain('MARTINI') for residue in cg_martini.get_residues(): print residue.resname, residue.child_list ARG [<Atom BB>, <Atom S1>, <Atom S2>] PRO [<Atom BB>, <Atom S1>] ASP [<Atom BB>, <Atom S1>] PHE [<Atom BB>, <Atom S1>, <Atom S2>, <Atom S3>] CYS [<Atom BB>, <Atom S1>] LEU [<Atom BB>, <Atom S1>] GLU [<Atom BB>, <Atom S1>] PRO [<Atom BB>, <Atom S1>] PRO [<Atom BB>, <Atom S1>] TYR [<Atom BB>, <Atom S1>, <Atom S2>, <Atom S3>] ...... CYS [<Atom BB>, <Atom S1>] GLY [<Atom BB>] GLY [<Atom BB>] ALA [<Atom BB>]
Removal of disordered atoms
Implement as part of Structure.py and based loosely on the contribution of Ramon Crehuet. The DisorderedAtom objects are removed from the residue and a single Atom object is added corresponding to the location of the user's choice (keep_loc argument) which defaults to A.
An example, still keeping s from above:
s = s.remove_disordered_atoms(verbose=True) 0 residues were modified # Now if we load a structure with disordered atoms ds = Struct.read('1MC2.pdb') ds.remove_disordered_atoms(verbose=True) Residue TRP:1010 has 8 disordered atoms: CD1/CD2/NE1/CE2/CE3/CZ2/CZ3/CH2 Residue VAL:1018 has 3 disordered atoms: CB/CG1/CG2 Residue LEU:1024 has 4 disordered atoms: CB/CG/CD1/CD2 Residue ARG:1043 has 7 disordered atoms: CB/CG/CD/NE/CZ/NH1/NH2 Residue MET:1092 has 4 disordered atoms: CB/CG/SD/CE Residue ARG:1107 has 7 disordered atoms: CB/CG/CD/NE/CZ/NH1/NH2 Residue GLU:1108 has 4 disordered atoms: CG/CD/OE1/OE2 Residue ASP:1111 has 4 disordered atoms: CB/CG/OD1/OD2 Residue SER:1116 has 1 disordered atoms: OG Residue SER:1131 has 1 disordered atoms: O 10 residues were modified
Sequence Homologues from Structures
Biopython supports BLAST (local and remote through NCBI servers). We bridged both Bio.PDB and Bio.Blast modules to allow an easier search for sequence homologues. For now, it supports remote BLAST through Bio.Blast.NCBIWWW and functions as a blackbox - i.e. users cannot change any search parameter. If one wants to fully use BLAST he/she should use the regular BLAST module. This is just a convenience function.
It is accessible only to Protein objects. It queries the PDB subset database of NCBI BLAST servers with the Structure object's sequence, auto-adjusting parameters for short sequences (less than 15 residues).
It returns a list ranked by Expectation Value with some informational values (e-value, identities, positives, gaps), the PDB code of the match, and the alignment.
from Bio import Struct s = Struct.read('1A8O.pdb') p = s.as_protein() seq_homologues = p.find_seq_homologues() for homologues in seq_homologues: print homologues[0], homologues[1] print homologues[-1] print 2BUO 1.82482e-31 DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW-TETLLVQNANPDCKTILKALGPGATLEE--TACQG DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW TETLLVQNANPDCKTILKALGPGATLEE TACQG DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG 1AUM 1.82482e-31 DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW-TETLLVQNANPDCKTILKALGPGATLEE--TACQG DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW TETLLVQNANPDCKTILKALGPGATLEE TACQG DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG .....
Support for MODELLER PIR format in SeqIO
MODELLER PIR format support was added to SeqIO as 'pir-modeller'. Currently, the format can be read but not written. An example of the format follows, as well as an example of the parser's usage.
>P1;5fd1 structureX:5fd1:1 :A:106 :A:ferredoxin:Azotobacter vinelandii: 1.90: 0.19 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER*
from Bio import SeqIO handle = open('test_pir.txt') records = SeqIO.parse(handle, 'pir-modeller') for i in records: print i ID: 5fd1 Name: 5fd1 Description: ferredoxin Number of features: 0 /r_factor= 0.19 /end_residue=106 /initial_chain=a /end_chain=a /record_type=X-Ray Structure /initial_residue=1 /resolution= 1.90 /source_organism=Azotobacter vinelandii Seq('AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAI...LER', ProteinAlphabet())